PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK31038.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family WRKY
Protein Properties Length: 158aa    MW: 18094.3 Da    PI: 4.7128
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK31038.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY893.8e-28106158254
                 --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES CS
        WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYeg 54 
                 dDgy+WrKYGqK++k+s++prsYY+Ct + C++kk+ve+s ++p++ +itYeg
  KFK31038.1 106 DDGYKWRKYGQKSIKNSPHPRSYYKCTNPICNAKKQVEKSIDEPNTYIITYEG 158
                 8**************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.802.4E-26100158IPR003657WRKY domain
PROSITE profilePS5081124.604100158IPR003657WRKY domain
SuperFamilySSF1182901.83E-23104158IPR003657WRKY domain
SMARTSM007745.4E-29105158IPR003657WRKY domain
PfamPF031067.1E-23106158IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 158 aa     Download sequence    Send to blast
MGEEEEEVYE WTRGFGDDYV DELLVNEPPL FFMPQEPPNE DAIKNKFLSS TLYSGPTIQD  60
ISNALTRTLP VPQVSISTVP TSEMSTLSRM DKYTLKVKNN CNGMSDDGYK WRKYGQKSIK  120
NSPHPRSYYK CTNPICNAKK QVEKSIDEPN TYIITYEG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-191041581670Probable WRKY transcription factor 4
2lex_A2e-191041581670Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB4937756e-89AB493775.1 Arabidopsis thaliana At5g43290 mRNA for hypothetical protein, partial cds, clone: RAAt5g43290.
GenBankAK1764436e-89AK176443.1 Arabidopsis thaliana mRNA for putative protein, complete cds, clone: RAFL24-21-D20.
GenBankBT0104246e-89BT010424.1 Arabidopsis thaliana At5g43290 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002862894.11e-78hypothetical protein ARALYDRAFT_921120
RefseqXP_002863670.11e-78hypothetical protein ARALYDRAFT_917333
SwissprotQ9FHR71e-75WRK49_ARATH; Probable WRKY transcription factor 49
TrEMBLA0A087GMD61e-115A0A087GMD6_ARAAL; Uncharacterized protein
STRINGscaffold_800733.13e-78(Arabidopsis lyrata)
STRINGscaffold_9700001.13e-78(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM94052637
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G43290.18e-77WRKY DNA-binding protein 49